PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.P1F7Y
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 67aa    MW: 7834.08 Da    PI: 9.3253
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.P1F7YgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-132867142
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42
                     rg+ T++E+e++v++++ lG++ W+ Ia +++ gRt +++k+
      Aradu.P1F7Y 28 RGNITPQEEEIIVKLHAVLGNR-WSVIAGHLP-GRTYNEIKN 67
                     8999******************.*********.*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.07E-161067IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-91134IPR009057Homeodomain-like
PROSITE profilePS5129419.8052367IPR017930Myb domain
SMARTSM007175.7E-42767IPR001005SANT/Myb domain
PfamPF002494.0E-112867IPR001005SANT/Myb domain
CDDcd001674.07E-73267No hitNo description
Gene3DG3DSA:1.10.10.601.8E-163567IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MEVVAQECWT LKSCRLRWIN YLRSDVKRGN ITPQEEEIIV KLHAVLGNRW SVIAGHLPGR  60
TYNEIKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-1412674398B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5737343e-42AB573734.1 Lupinus albus LaMYB11 mRNA for R2R3-MYB transcription factor, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016172314.12e-31PREDICTED: transcription factor MYB12
SwissprotO222646e-30MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A0B2P2425e-31A0A0B2P242_GLYSO; Transcription factor MYB12
TrEMBLA0A0B2P5Q95e-31A0A0B2P5Q9_GLYSO; Transcription factor MYB12
TrEMBLK7L3L15e-31K7L3L1_SOYBN; Uncharacterized protein
TrEMBLK7MJQ15e-31K7MJQ1_SOYBN; Uncharacterized protein
STRINGGLYMA07G37142.11e-30(Glycine max)
STRINGGLYMA17G03480.21e-30(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.13e-31myb domain protein 12